AnaSpec Introduces Fifty-Five New Catalog Peptides
Released on = February 8, 2007, 8:32 am
Press Release Author = Debra Thai
Industry = Biotech
Press Release Summary = This week AnaSpec, one of the world's largest providers of custom and catalog peptides, introduced fifty-five new peptides for drug discovery research.
Press Release Body = Peptides/Amyloid Peptides Beta-Amyloid (1-15) (Cat# 61798) Sequence: DAEFRHDSGYEVHHQ Sequence (3-Letter): H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-OH
Beta-Amyloid (7-22) (Cat# 61803) This beta Amyloid 7 to 22 amino acid residues peptide was utilized in studies of the catabolism of the b-amyloid peptides. This peptide contains several potential iodination sites. Sequence: DSGYEVHHQKLVFFAE Sequence (3-Letter): H-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-OH Reference(s): Ghiso, J. et al. J. Biol. Chem. 279, 45897 (2004).
Biotin-LC-beta-Amyloid(1-40), mouse, rat (Cat# 61717-01) Sequence: Biotin-LC-DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV Sequence (3-Letter): Biotin-LC-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val
Biotin-LC-beta-Amyloid(1-40), mouse, rat (Cat# 61717-05) Sequence: Biotin-LC-DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV Sequence (3-Letter): Biotin-LC-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val
Biotin-LC-beta-Amyloid(1-40), mouse, rat (Cat# 61717-1) Sequence: Biotin-LC-DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV Sequence (3-Letter): Biotin-LC-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val
Beta-Amyloid (1-34) (Cat# 61799) Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL Sequence (3-Letter): H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-OH
Peptides/Bacterial Peptides P69 (522-534), M. leprae (Cat# 61688) A Mycobacteria leprae heat shock protein (M. leprae HSP65)-specific epitope. This peptide is recognized by M. leprae HSP65-reactive CD4+ T-cell clones. Sequence: PEKTAAPASDPTG Sequence (3-Letter): H-Pro-Glu-Lys-Thr-Ala-Ala-Pro-Ala-Ser-Asp-Pro-Thr-Gly-OH Reference(s): Mustafa, A. et al. Infect. Immun. 67, 5683 (1999).
Peptides/Ghrelin Peptides Biotin-Ghrelin, bovine (Cat# 61714) This is a biotinylated form of the bovine grhelin peptide. The octanoyl modification at Ser3 (n-octanoyl Ghrelin) is the major active form of ghrelin. Ghrelin is a peptide hormone produced by the stomach in mammals, but also detectable in many other tissues. Endogenous Ghrelin participates in the regulation of food intake, body weight, energy homeostasis, it is an endogenous ligand for the growth hormone secretagogue receptor (GHS-R) and is involved in the release of growth hormone from the anterior pituitary. Sequence: GS-S(n-octanoylated)-FLSPEHQKLQRKEAKKPSGRLKPR Sequence (3-Letter): H-Gly-Ser-Ser(n-octanoylated)-Phe-Leu-Ser-Pro-Glu-His-Gln-Lys-Leu-Gln-Arg-Lys-Glu-Ala-Lys-Lys-Pro-Ser-Gly-Arg-Leu-Lys-Pro-Arg-OH Reference(s): ThidarMyint, H. et al. J. Endocrinol. 189, 655 (2006); Gauna, C. et al. J. Clin. Endo. Metab. 90, 1055 (2005); Currie, P. et al. Am. J. Physiol. Regul. Integr. Comp. Physiol. 289, R353 (2005); Arvat, E. et al. J. Clin. Endo. Metab 86, 1169 (2001).
Peptides/Protein Phosphorylation Related Peptides (pS8, pS13) Eucariotic Translation Initiation Factor 2B, eIF2B (Cat# 61739) This is an eukaryotic protein synthesis initiation factor 2B (elF2B), the double phosphorylated amidated peptide. Dephosphorylation of this peptide by insulin signaling and glycogen synthase kinase 3 (GSK3) inhibition leads to its activation. The references below correspond to the single phosphorylated peptide. Sequence: RRAAEELDpSRAGpSPQL Sequence (3-Letter): H-Arg-Arg-Ala-Ala-Glu-Glu-Leu-Asp-pSer-Arg-Ala-Gly-pSer-Pro-Gln-Leu-OH Reference(s): Frame, S. et al. Mol. Cell. 7, 1321 (2001); Orea, S. et al. J. Biol. Chem. 275, 15765 (2000); Kang Ho Kim, et al. J. Biol. Chem. 279, 51999 (2004); Niloulina, S. et al. Diabetes 51, 2190 (2002); Brady, M. et al. J. Biol. Chem. 273, 14063 (1998).
Gycogen Synthase-derived peptide, phosphorylated, TAMRA-labeled (Cat# 61725) A TAMRA-labeled phosphorylated Glycogen synthese derived peptide (Ab/Em
Web Site = http://www.anaspec.com
Contact Details = 2149 O\'Toole Ave. San Jose, CA 95131 Tel: 408-452-5055 Fax: 408-452-5059 service@anaspec.com www.anaspec.com
Printer
Friendly Format
Back
to previous page...
Back
to home page...
Submit
your press releases...
|